PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12465_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 691aa    MW: 76730.3 Da    PI: 4.449
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12465_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-12539580346
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rWT+++ el+++avkq+G++  + I + ++ gRt+ q+k+++ k
  cra_locus_12465_iso_1_len_2228_ver_3 539 RWTKQDTELFYEAVKQFGTD-LSMIQQLFP-GRTRRQVKLKYKK 580
                                           8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159635.4E-27530611No hitNo description
PROSITE profilePS512939.482535583IPR017884SANT domain
SMARTSM007171.2E-8536584IPR001005SANT/Myb domain
CDDcd001674.47E-8539580No hitNo description
Gene3DG3DSA:1.10.10.601.1E-6539580IPR009057Homeodomain-like
SuperFamilySSF466895.23E-11539586IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
XGXKIHLDWV LADGQGSSGI VNAPSVDAGT TENVNSTVGL DPGVSIFIPD SNEDWGSCFE  60
KSVGENGDIF IGLESFGDFL PDSSAVIDNS VPSSEAPAVD VPGSSNTEEG RIDPTVPAVD  120
DSACFSDVPG ISSQPETSAA EDPLTGPETI ISASHGDDRD LDKEDLESYP CLETLDISEL  180
ANRSGRRIGK FQPKPKSQLE RHQTNISDLD LVHPVPTVSR QQDSQLVPPE VNFVDHGLVT  240
ASTQNDILEF SSVGLSGPAA EIASEAEESN PIEPSHAGAG IPGEHLESVP GKLTSRRAKT  300
GKSRKTVSDH LSPEHPTSNQ TETAGRVLRK RQNNNNVYQL RDESEDEVVA DGDLPSSSPS  360
VFAAKGNKND DQEYQPENES LTKKVKKSKK TPGDKEKPVR KQKKDNETSD QTAKAAPKKF  420
LHSTRRRRVN KTLLETPEDE IDFQKVPLRD LILLAEHKER MAKKEATPSR APPSNHSAGD  480
FVEPDNEDRG GDDFQQYYDE PFASEQGGEA NDKESSPRVQ ENSEYFNYQT YMDKTPIARW  540
TKQDTELFYE AVKQFGTDLS MIQQLFPGRT RRQVKLKYKK EERQHPLRLR DALTNRARDH  600
SHFELVIDRL RQLAAEEKQN SDKAESVDLT AEEEAEEEAP ETSDKEGKSE QMDEEMMEKT  660
EPDYNKQVQS PVKTYDSEDD LLLWNQYKSE E
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068VEV10.0A0A068VEV1_COFCA; Uncharacterized protein